PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF026500080CFD_t1
Common NameTRAES_3BF026500080CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 272aa    MW: 29352 Da    PI: 6.6323
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF026500080CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-172976148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT+eEde lv+ v++ G g+W+t +r+ g+ R++k+c++rw +yl
  TRAES3BF026500080CFD_t1 29 RGPWTAEEDEVLVRFVAREGEGRWRTLPRRAGLLRCGKSCRLRWMNYL 76
                             89******************************99************97 PP

2Myb_DNA-binding46.11.1e-1483127248
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              g+  ++E++l++++++ lG++ W++Ia +++ gRt++++k++w+++l
  TRAES3BF026500080CFD_t1  83 GPIAEDEEDLILRLHRVLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 127
                              666799***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3052476IPR017930Myb domain
SuperFamilySSF466891.83E-2926123IPR009057Homeodomain-like
SMARTSM007171.5E-122878IPR001005SANT/Myb domain
PfamPF002492.0E-142976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-213083IPR009057Homeodomain-like
CDDcd001676.94E-113176No hitNo description
PROSITE profilePS5129425.32277131IPR017930Myb domain
SMARTSM007177.4E-1481129IPR001005SANT/Myb domain
PfamPF002493.2E-1383127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-2584132IPR009057Homeodomain-like
CDDcd001671.55E-1187127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MARRKPPAQH GARSEDGQAQ STAPPPLKRG PWTAEEDEVL VRFVAREGEG RWRTLPRRAG  60
LLRCGKSCRL RWMNYLRPDI KRGPIAEDEE DLILRLHRVL GNRWSLIAGR LPGRTDNEIK  120
NYWNSHLSKK LIAQGLDPRT HMPLAAAPGK TAAATHKTTA APVVVPPQPP PPPGPVLPTS  180
SAAGTGSDGH DNPGDGGNDD LAATMSVDAD GFEGFGDQLL ADYAASRGGF EDVMGCPMVD  240
DDTFTSFLDS LMNERQLAAD HKGVMNDQGG AI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29251313108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3765620.0AK376562.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3127N16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567025.11e-117PREDICTED: transcription repressor MYB5-like
SwissprotQ388507e-76MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A077RTE80.0A0A077RTE8_WHEAT; Uncharacterized protein
STRINGMLOC_16037.31e-154(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.17e-70myb domain protein 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]